Home Products Chemicals Resin

muscle growth hormone

Refine Search
Results formuscle growth hormonefrom 28329 Products.
... and Coenzymes Grade Standard: Medicine Grade Analysis : Enterprise standard Appearance : White Lyophilized Powder Detailed description: Growth failure of children due to ...
HongKong, china
Verified
...: White powder Specification: 1mg/vial, 10 vials/box Application: Pharm Intermediates or research Function: Increase muscle mass, bone density, exercise capacity and protein ...
Zhejiang, china
Verified
...Test Cyp Strongest Injectable Anabolic Steroids For Gaining Muscle Without Pain Test cyp------------200mg/ml 250mg/ml 300mg/ml 1.Test Cypionate 5 gram conversion 20ml @ ...
Guangdong, china
Verified
...Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 USP Standard Oxandrolone / Anavar Quick Info Product Name: Oxandrolone CAS: ...
Hubei, china
Verified
...FOLLISTATIN 344 Nature Muscle Growth Hormone Injections Peptides Cryopreservation Detailed Product Description Appearance: Powder Purity: 99.9% Production Capacity: 1000kg/month ...
Shandong, china
Verified
...Human Growth Hormone Peptide IGF-1 LR3 1mg For Natural Muscle Growth Quick detial Product name: IGF-1Lr3 Appearance:White lyophilized powder Specification: 1mg/vial Packing...
Hubei, china
Verified
...Muscle Growth Steroids Powder Epistane / Methylepitiostanol CAS 4267-80-5 Quick Detail: Name Epistane Synonyms Epi Other Names ...
Guangdong, china
Verified
...Nolvadex Tamoxifen Citrate Muscle Growth Hormone Genox Tamifen 10540-29-1 Tamoxifen: 10mg x 60 tablets/bottle is available. Nolvadex (tamoxifen citrate) is a ...
HongKong, china
Member
...FOLLISTATIN 344 Nature Muscle Growth Hormone Injections Peptides Cryopreservation Detailed Product Description Appearance: Powder Purity: 99.9% Production Capacity: 1000kg/month ...
Verified
...Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 USP Standard Oxandrolone / Anavar Quick Info Product Name: Oxandrolone CAS: ...
Guangxi, china
Verified
...Melanotan 2 Lean Muscle Growth Hormone Peptides Muscle Building Melanotan II Description: Melanotan 2 is a synthetically created peptide that stimulates skin tanning, increased ...
Shanghai, china
Verified
...Fat Burning Human Growth Hormone Peptide Releasing GHRP-6 for Lean Muscle Mass 99.5% Purity CAS 87616-84-0 Description GHRP-6 is an injectable peptide in the category of growth ...
Hubei, china
Verified
...Muscle Growth Hormone Peptides Hgh Fragment 176-191 (2mg/vial) For Bodybuilding Supplements Contact:Cindy Email:bulksteroid@ycgmp....
Hubei, china
Verified
...Muscle Growth Hormones Anabolic Steroid Powder 1- Testosterone Cypionate / 1 - Tc / Dihydrobolden Cypionate Testosterone Steroid Product Details Product Name: Dihydrobolden ...
Guangdong, china
Verified
...Muscle Growth Hormone Peptides Bodybuilding 1mg / Vial Follistatin 315 Fst -315 Quick Detail: Product Name: Follistatin 315 Appearance: ...
Shandong, china
Verified
...Legit Human Growth Hormone Gensic HGH hygetrpin 200iu for bodybuilding Guarantee safe shipping Hygetropin 200iu 25iu/vial, 10vials/kit ...
HongKong, china
Verified
... dosage and good results for testosterone cypionate cycle Testosterone is a hormone produced by all human beings and is the primary male sex hormone. Through our discussion, ...
HongKong, china
Verified
...Raw Muscle Growth Hormone Powder Turinabol Clostebol Acetate CAS855-19-6 Alias: Megagrisevit; Clostebol acetate CAS No: 855-19-6 Einecs ...
Zhejiang, china
Verified
...IGF-1DES 1mg / vial Muscle Growth Hormone Peptides Protection 1. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 2. Molar Mass: 7,372 Da 3. ...
Hubei, china
Verified
CJC-1295 without DAC from Peptides 1.Quick Detail: Product Name: CJC-1295 English name: CJC-1295 (without DAC) CAS number: 863288-34-0 Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu...
Macau, china
Verified
Page 1 of 50 |< << 1 2 3 4 5 6 7 8 9 10 >> >|