Home Products Chemicals

Flavour and Fragrance

Subcategories offlavour and fragrance
Refine Search

Location

Business Type

Results forflavour and fragrance: 1090 Products.
Paclitaxel Pharmaceutical Raw Materials Used to Anti-Cancer (33069-62-4) Taxus Chinensis Extract Basic info: Paclitaxel Synonyms: N-BENZYL-BETA-PHENYLISOSERINE ESTER CAS: 33069-62...
2018-02-07
Verified
Human Growth Peptide Gdf-8 CAS 307297-39-8 Myostatin Blockers Myostatin/ GDF-8 description : Product name:Myostatin GDF-8 Purity:95% Specification:1mg/vial Appearance:White powder ...
2018-02-06
Verified
SARMs Powder SR9009 (Stenabolic) For Bodybuilding CAS No.: 1379686-30-2 Just try a small order to start our cooperation, we will NOT make you down ! Any products interested pls let ...
2018-02-08
Verified
Please kindly contact us to know more Contact Hope Whatsapp: +86-18164245853 Email : hope@chembj.com White Nandrolone Decanoate DECA Durabolin Steroid / DECA Durabolin Powder CAS ...
2018-02-05
Verified
Muscle Gaining Sr9009 Raw Powder CAS: 1379686-30-2 / Purity: 99.48% Product Description Name SR9009 Systematic (IUPAC) name ethyl-3-(((4-chlorobenzyl)((5-nitrothiophen-2-yl)methyl...
2018-02-11
Verified
Betamethasone 17,21-dipropionate Quick details English Synonyms: BETAMETHASONE DIPROPIONATE;BETAMETHASONE 17,21-DI-PROPIONATE;BETAMETHASONE 17-ALPHA,21-DIPROPIONATE;1,4-PREGNADIEN...
JCJ Logis Co.,ltd [North America] china
2018-01-25
Verified
Pharmaceuticals Tianeptine Sodium Salt CAS 30123-17-2 for Antidepressant Product Name: Tianeptine sodium salt Synonyms: TIANEPTINE SODIUM;TIANEPTINE SODIUM SALT;sodium 7-((3-chloro...
2018-02-06
Verified
Acid Protease AP-0800S for Animal Feed Improves digestibility of proteins contained in feedstuff DESCRIPTION Acid Protease AP-0800S is produced from Aspergillus niger through ...
2018-02-13
Verified
Quick Drying Petroleum Hydrocarbon C9 Resin HC - 9140 in Newspaper Printing Ink Product Name: Petroleum Hydrocarbon C9 Resin Type: HC - 9140 Process: Cold Polymerization Descriptio...
2018-01-31
Verified
Metribolone 965-93-5 yellow powder trenbolone steroid hormone 1. Product name : Metribolone 2. Alias: Methyl trenbolone ; Methyltrienolone 3. CAS No: 965-93-5 4. MF: C19H24O2 5. MW...
2018-02-07
Verified
Testosterone boldenone 99% Testosterone Decanoate For intramuscular injection Testosterone Decanoate (Steroids) Test Dec Testosterone Dec Test Decanoate Test Dec CAS: 5721-91-5 ...
2017-11-28
Verified
Anti Estrogen Synthetic Anabolic Steroids Oral Clomiphene Citrate Clomid CAS 50-41-9 Product Name: Clomiphene Citrate Alias: Clomiphene Citrate CAS NO.: 50-41-9 Purity: 99% ...
Yihan Industrial Co.,Ltd. [North America] china
2017-11-24
Verified
Authentic Eleaf 30 watt 2200mAh iStick 30W Box Mod VV VW Eleaf iStick30 Mod Skype:yuwang1229 Eleaf iStick 30W Quick View Model iStick 30w Color Black, Silver, Red And Blue Color ...
Please input your companyname! [North America] china
2016-07-12
Member
White Lyophilized Powder Myostatin GDF-8 Injectable Human Polypeptides Hormone Myostatin Myostatin (also known as growth differentiation factor 8, abbreviated GDF-8) is a myokine, ...
Guangzhou Kafen Biotech Co.,Ltd [North America] china
2016-08-31
Verified
Yellow Liquid Semi-Finishied Steroids Oils Injectable Trenbolone Acetate 80mg/mL For Body-Building​ Recipe: 80mg/ml @ 250ml 20 gram Trenbolone Acetate powder (15mL) 5mL BA (2%) ...
2017-05-17
Verified
Naphyrone, also known as O-2482 and naphthylpyrovalerone,[3] is a drug derived from pyrovalerone that acts as atriple reuptake inhibitor,[4] producing stimulant effects and has ...
2017-12-27
Verified
Testosterone Anabolic Steroid Testosterone Decanoate Powder CAS 5721-91-5 For Gain Muscle Quick Details: Synonyms: testosterone decanoate;4-Androsten-17beta-ol-3-one Decanoate CAS: ...
2017-12-28
Verified
GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial Basic Info. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molar ...
Biopro Chemicals Co., Ltd. [North America] china
2017-04-11
Verified
Ningbo Bud Fashion Co.,Ltd, which is a professional and liable manufacturer specializing in knitwear for 15 years with excellent quality and reasonable price. Our successful cases ...
Ningbo Bud Fashion Co Ltd [North America] china
2018-02-01
Member
CAS 434-07-1 Anadrol Muscle Mass Cutting Cycle Steroids Oxymetholone Quick Detail: Product name Oxymetholone (Anadrol) Other name 17-alpha-Methyl-2-hydroxymethylene-17-hydroxy-5...
Wuhan Body Biological Co.,Ltd [North America] china
2017-08-21
Verified
Page 1 of 50 |< << 1 2 3 4 5 6 7 8 9 10 >> >|